Lineage for d5xi5c1 (5xi5 C:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121690Protein automated matches [226837] (7 species)
    not a true protein
  7. 2121954Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries)
  8. 2121975Domain d5xi5c1: 5xi5 C:1-245 [340403]
    Other proteins in same PDB: d5xi5a2, d5xi5b2, d5xi5c2, d5xi5d2, d5xi5e_, d5xi5f1, d5xi5f2
    automated match to d4ihja1
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5xi5c1

PDB Entry: 5xi5 (more details), 2.81 Å

PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5xi5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xi5c1 c.32.1.1 (C:1-245) automated matches {Sus barbatus [TaxId: 41807]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5xi5c1:

Click to download the PDB-style file with coordinates for d5xi5c1.
(The format of our PDB-style files is described here.)

Timeline for d5xi5c1: