Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) automatically mapped to Pfam PF02560 |
Family d.72.1.0: automated matches [271343] (1 protein) not a true family |
Protein automated matches [271344] (1 species) not a true protein |
Species Serratia proteamaculans [TaxId:399741] [271345] (2 PDB entries) |
Domain d6b6me2: 6b6m E:87-156 [340402] Other proteins in same PDB: d6b6ma1, d6b6mb1, d6b6mc1, d6b6md1, d6b6me1 automated match to d4y42a2 |
PDB Entry: 6b6m (more details), 1.91 Å
SCOPe Domain Sequences for d6b6me2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b6me2 d.72.1.0 (E:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]} gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl dgkylptkpf
Timeline for d6b6me2: