Lineage for d1qk4b_ (1qk4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128418Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)
  7. 2128422Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)
  8. 2128432Domain d1qk4b_: 1qk4 B: [34038]
    complexed with imp

Details for d1qk4b_

PDB Entry: 1qk4 (more details), 1.9 Å

PDB Description: toxoplasma gondii hypoxanthine-guanine phosphoribosyltransferase imp complex
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1qk4b_:

Sequence, based on SEQRES records: (download)

>d1qk4b_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfe

Sequence, based on observed residues (ATOM records): (download)

>d1qk4b_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqg
qltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsns
lkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfe

SCOPe Domain Coordinates for d1qk4b_:

Click to download the PDB-style file with coordinates for d1qk4b_.
(The format of our PDB-style files is described here.)

Timeline for d1qk4b_: