Lineage for d5xi5d1 (5xi5 D:1-243)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries) 
Domain d5xi5d1: 5xi5 D:1-243 [340361]
Other proteins in same PDB: d5xi5a2, d5xi5b2, d5xi5c2, d5xi5d2, d5xi5e_, d5xi5f1, d5xi5f2, d5xi5f3
automated match to d4drxb1
complexed with acp, ca, gdp, gtp, mes, mg, pn6
Details for d5xi5d1
PDB Entry: 5xi5 (more details), 2.81 Å
PDB Description: crystal structure of t2r-ttl-po5 complex
PDB Compounds: (D:) Tubulin beta chainSCOPe Domain Sequences for d5xi5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xi5d1 c.32.1.1 (D:1-243) automated matches {Sus barbatus [TaxId: 41807]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
SCOPe Domain Coordinates for d5xi5d1:
Click to download the PDB-style file with coordinates for d5xi5d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5xi5d1:
View in 3D
