SCOPe 2.08: Domain d5wslb1: 5wsl B:1-279

Lineage for d5wslb1 (5wsl B:1-279)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.0: automated matches [191390] (1 protein)
   not a true family

6. Protein automated matches [190500] (10 species)
   not a true protein

7. Species Meiothermus taiwanensis [TaxId:1339250] [340350] (1 PDB entry)

8. Domain d5wslb1: 5wsl B:1-279 [340351]
   Other proteins in same PDB: d5wsla2, d5wslb2, d5wslc2
   automated match to d4dzta_
   complexed with ca, so4

Details for d5wslb1

PDB Entry: 5wsl, 1.5 Å

PDB Description: structural studies of keratinase from meiothermus taiwanensis wr-220

PDB Compounds: (B:) keratinase

SCOPe Domain Sequences for d5wslb1:

Sequence; same for both SEQRES and ATOM records:

>d5wslb1 c.41.1.0 (B:1-279) automated matches {Meiothermus taiwanensis [TaxId: 1339250]}
atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
npsaspatvrnaivgnatsgvvsnagrrspnlllysnye

Timeline for d5wslb1:

• d5wslb1 first appeared in SCOPe 2.06, called d5wslb_
  
• d5wslb1 was called d5wslb_ in SCOPe 2.07