Lineage for d5xcha_ (5xch A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998458Family d.159.1.0: automated matches [191347] (1 protein)
    not a true family
  6. 2998459Protein automated matches [190255] (6 species)
    not a true protein
  7. 2998472Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [339925] (4 PDB entries)
  8. 2998479Domain d5xcha_: 5xch A: [340339]
    automated match to d1z2wa1
    complexed with zn

Details for d5xcha_

PDB Entry: 5xch (more details), 2.85 Å

PDB Description: crystal structure of wild type vps29 complexed with zn+2 from entamoeba histolytica
PDB Compounds: (A:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5xcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcha_ d.159.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mlvlvigdfhvphrsaaipqvfldrlntgriqtvlctgnlcgketydilrtlarevhvvk
gdfdemqglnetevikignfkiglmhghqvipwgdrealaiyqrqldvdilitghthkle
tkevggkyflnpgsatgaysplvdnpvpsfmlleindseltiyeytlvdgsvkcervdfn

SCOPe Domain Coordinates for d5xcha_:

Click to download the PDB-style file with coordinates for d5xcha_.
(The format of our PDB-style files is described here.)

Timeline for d5xcha_: