Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.0: automated matches [191347] (1 protein) not a true family |
Protein automated matches [190255] (6 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [339925] (4 PDB entries) |
Domain d5xcha_: 5xch A: [340339] automated match to d1z2wa1 complexed with zn |
PDB Entry: 5xch (more details), 2.85 Å
SCOPe Domain Sequences for d5xcha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xcha_ d.159.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} mlvlvigdfhvphrsaaipqvfldrlntgriqtvlctgnlcgketydilrtlarevhvvk gdfdemqglnetevikignfkiglmhghqvipwgdrealaiyqrqldvdilitghthkle tkevggkyflnpgsatgaysplvdnpvpsfmlleindseltiyeytlvdgsvkcervdfn
Timeline for d5xcha_: