Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Human papillomavirus [TaxId:10566] [189523] (1 PDB entry) |
Domain d5w1oc1: 5w1o C:21-474 [340320] Other proteins in same PDB: d5w1oa2, d5w1ob2, d5w1oc2, d5w1od2, d5w1oe2 automated match to d1dzla_ |
PDB Entry: 5w1o (more details), 2.8 Å
SCOPe Domain Sequences for d5w1oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w1oc1 b.121.6.1 (C:21-474) automated matches {Human papillomavirus [TaxId: 10566]} vvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpdp nkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaanag vdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgdm vdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrhl fnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqghn ngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlck itltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrkf llqagl
Timeline for d5w1oc1: