SCOPe 2.06: Domain d5wiga_: 5wig A:

Lineage for d5wiga_ (5wig A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d5wiga_: 5wig A: [340318]
   automated match to d4u4la_
   complexed with zn

Details for d5wiga_

PDB Entry: 5wig, 1.4 Å

PDB Description: structure of new delhi metallo-beta-lactamase 4 (ndm-4)

PDB Compounds: (A:) ndm-4

SCOPe Domain Sequences for d5wiga_:

Sequence; same for both SEQRES and ATOM records:

>d5wiga_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d5wiga_:

• d5wiga_ is new in SCOPe 2.06-stable
  
• d5wiga_ appears in SCOPe 2.07
  
• d5wiga_ appears in the current release, SCOPe 2.08