Lineage for d5vg3c_ (5vg3 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814680Protein automated matches [190784] (2 species)
    not a true protein
  7. 2814681Species Bacillus subtilis [TaxId:1423] [188035] (8 PDB entries)
  8. 2814686Domain d5vg3c_: 5vg3 C: [340308]
    automated match to d2uyba_
    complexed with act, gol, mn, mpd

Details for d5vg3c_

PDB Entry: 5vg3 (more details), 1.45 Å

PDB Description: structure of oxalate decarboxylase from bacillus subtilis at ph 4.6
PDB Compounds: (C:) Oxalate decarboxylase

SCOPe Domain Sequences for d5vg3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vg3c_ b.82.1.2 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

SCOPe Domain Coordinates for d5vg3c_:

Click to download the PDB-style file with coordinates for d5vg3c_.
(The format of our PDB-style files is described here.)

Timeline for d5vg3c_: