SCOPe 2.06: Domain d5ov7c2: 5ov7 C:246-440

Lineage for d5ov7c2 (5ov7 C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)

8. Domain d5ov7c2: 5ov7 C:246-440 [340282]
   Other proteins in same PDB: d5ov7a1, d5ov7b1, d5ov7c1, d5ov7d1, d5ov7e_, d5ov7f1, d5ov7f2, d5ov7f3
   automated match to d4i50a2
   complexed with 6fs, acp, ca, gdp, gol, gtp, mes, mg

Details for d5ov7c2

PDB Entry: 5ov7, 2.4 Å

PDB Description: tubulin - rigosertib complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ov7c2:

Sequence; same for both SEQRES and ATOM records:

>d5ov7c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5ov7c2:

• d5ov7c2 is new in SCOPe 2.06-stable
  
• d5ov7c2 appears in SCOPe 2.07
  
• d5ov7c2 appears in the current release, SCOPe 2.08