Lineage for d5ocrd_ (5ocr D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779149Protein kappa-Carrageenase, catalytic [49930] (2 species)
    1,3-alpha-1,4-beta-D-galactose-4-sulfate-3,6-anhydro-D-galactose 4 galactohydrolase
  7. 2779154Species Zobellia galactanivorans [TaxId:63186] [340263] (1 PDB entry)
  8. 2779158Domain d5ocrd_: 5ocr D: [340267]
    automated match to d1dypa_
    complexed with gol, mg

Details for d5ocrd_

PDB Entry: 5ocr (more details), 1.66 Å

PDB Description: crystal structure of the kappa-carrageenase zobellia_236 from zobellia galactanivorans
PDB Compounds: (D:) kappa-carrageenase

SCOPe Domain Sequences for d5ocrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocrd_ b.29.1.2 (D:) kappa-Carrageenase, catalytic {Zobellia galactanivorans [TaxId: 63186]}
qqptktsnpndqwtikwsasdefnkndpdwakwiktgnlpntsawkwnnqknvkisngia
eltmrhnanntpdggtyftsgifksyqkftygyfeakiqgadigegvcpsfwlysdfdys
vangetvyseidvvelqqfdwyeghqddiydmdlnlhavvkengqgvwkrpkmypqeqln
kwrapwdpskdfhiygcevnqneiiwyvdgvevarkpnkywhrpmnvtlslglrkpfvkf
fdnknnainpetdakareklsdiptsmyvdyvrvweks

SCOPe Domain Coordinates for d5ocrd_:

Click to download the PDB-style file with coordinates for d5ocrd_.
(The format of our PDB-style files is described here.)

Timeline for d5ocrd_: