Lineage for d5o2ya1 (5o2y A:25-132)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. Family d.24.1.3: Pseudopilin [117865] (2 proteins)
    automatically mapped to Pfam PF08334
  6. Protein automated matches [191070] (2 species)
    not a true protein
  7. Species Klebsiella oxytoca [TaxId:571] [340259] (1 PDB entry)
  8. Domain d5o2ya1: 5o2y A:25-132 [340260]
    Other proteins in same PDB: d5o2ya2
    automated match to d3g20b_
    complexed with ca

Details for d5o2ya1

PDB Entry: 5o2y (more details)

PDB Description: nmr structure of the calcium bound form of pulg, major pseudopilin from klebsiella oxytoca t2ss
PDB Compounds: (A:) General secretion pathway protein G

SCOPe Domain Sequences for d5o2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2ya1 d.24.1.3 (A:25-132) automated matches {Klebsiella oxytoca [TaxId: 571]}
mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtig

SCOPe Domain Coordinates for d5o2ya1 are not available.

Timeline for d5o2ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o2ya2