SCOPe 2.08: Domain d5o2ya1: 5o2y A:25-132

Lineage for d5o2ya1 (5o2y A:25-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.3: Pseudopilin [117865] (2 proteins)
   automatically mapped to Pfam PF08334

6. Protein automated matches [191070] (2 species)
   not a true protein

7. Species Klebsiella oxytoca [TaxId:571] [340259] (1 PDB entry)

8. Domain d5o2ya1: 5o2y A:25-132 [340260]
   Other proteins in same PDB: d5o2ya2
   automated match to d3g20b_
   complexed with ca

Details for d5o2ya1

PDB Entry: 5o2y

PDB Description: nmr structure of the calcium bound form of pulg, major pseudopilin from klebsiella oxytoca t2ss

PDB Compounds: (A:) General secretion pathway protein G

SCOPe Domain Sequences for d5o2ya1:

Sequence; same for both SEQRES and ATOM records:

>d5o2ya1 d.24.1.3 (A:25-132) automated matches {Klebsiella oxytoca [TaxId: 571]}
mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtig

Timeline for d5o2ya1:

• d5o2ya1 first appeared in SCOPe 2.06
  
• d5o2ya1 appears in SCOPe 2.07