![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
![]() | Superfamily d.24.1: Pili subunits [54523] (8 families) ![]() bacterial filament proteins |
![]() | Family d.24.1.3: Pseudopilin [117865] (2 proteins) automatically mapped to Pfam PF08334 |
![]() | Protein automated matches [191070] (2 species) not a true protein |
![]() | Species Klebsiella oxytoca [TaxId:571] [340259] (1 PDB entry) |
![]() | Domain d5o2ya1: 5o2y A:25-132 [340260] Other proteins in same PDB: d5o2ya2 automated match to d3g20b_ complexed with ca |
PDB Entry: 5o2y (more details)
SCOPe Domain Sequences for d5o2ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o2ya1 d.24.1.3 (A:25-132) automated matches {Klebsiella oxytoca [TaxId: 571]} mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtig
Timeline for d5o2ya1: