Lineage for d1a97c_ (1a97 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25845Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 25846Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 25847Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 protein domains)
  6. 25956Protein Xantine-guanine PRTase (XPRTase) [53273] (1 species)
  7. 25957Species Escherichia coli [TaxId:562] [53274] (5 PDB entries)
  8. 25972Domain d1a97c_: 1a97 C: [34025]

Details for d1a97c_

PDB Entry: 1a97 (more details), 2.6 Å

PDB Description: xprtase from e. coli complexed with gmp

SCOP Domain Sequences for d1a97c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a97c_ c.61.1.1 (C:) Xantine-guanine PRTase (XPRTase) {Escherichia coli}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvaiss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppis

SCOP Domain Coordinates for d1a97c_:

Click to download the PDB-style file with coordinates for d1a97c_.
(The format of our PDB-style files is described here.)

Timeline for d1a97c_: