Lineage for d5h1pa_ (5h1p A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2563002Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. 2563003Protein automated matches [190980] (6 species)
    not a true protein
  7. 2563023Species Xanthomonas albilineans [TaxId:380358] [340246] (2 PDB entries)
  8. 2563026Domain d5h1pa_: 5h1p A: [340248]
    automated match to d3oq2b_
    complexed with act

Details for d5h1pa_

PDB Entry: 5h1p (more details), 1.75 Å

PDB Description: crispr-associated protein
PDB Compounds: (A:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d5h1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1pa_ d.58.58.0 (A:) automated matches {Xanthomonas albilineans [TaxId: 380358]}
mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
pdidslrfyhlgakwearvehvgakp

SCOPe Domain Coordinates for d5h1pa_:

Click to download the PDB-style file with coordinates for d5h1pa_.
(The format of our PDB-style files is described here.)

Timeline for d5h1pa_: