| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
| Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
| Protein automated matches [190980] (6 species) not a true protein |
| Species Xanthomonas albilineans [TaxId:380358] [340246] (2 PDB entries) |
| Domain d5h1pa_: 5h1p A: [340248] automated match to d3oq2b_ complexed with act |
PDB Entry: 5h1p (more details), 1.75 Å
SCOPe Domain Sequences for d5h1pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h1pa_ d.58.58.0 (A:) automated matches {Xanthomonas albilineans [TaxId: 380358]}
mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
pdidslrfyhlgakwearvehvgakp
Timeline for d5h1pa_: