Lineage for d5h1pa_ (5h1p A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. Protein automated matches [190980] (6 species)
    not a true protein
  7. Species Xanthomonas albilineans [TaxId:380358] [340246] (2 PDB entries)
  8. Domain d5h1pa_: 5h1p A: [340248]
    automated match to d3oq2b_
    complexed with act

Details for d5h1pa_

PDB Entry: 5h1p (more details), 1.7500000000000002 Å

PDB Description: crispr-associated protein
PDB Compounds: (A:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d5h1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1pa_ d.58.58.0 (A:) automated matches {Xanthomonas albilineans [TaxId: 380358]}
mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
pdidslrfyhlgakwearvehvgakp

SCOPe Domain Coordinates for d5h1pa_ are not available.

Timeline for d5h1pa_:

Domains from other chains:
(mouse over for more information)
d5h1pb_