SCOPe 2.08: Domain d5h1pb_: 5h1p B:

Lineage for d5h1pb_ (5h1p B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Xanthomonas albilineans [TaxId:380358] [340246] (2 PDB entries)

8. Domain d5h1pb_: 5h1p B: [340247]
   automated match to d3oq2b_
   complexed with act

Details for d5h1pb_

PDB Entry: 5h1p, 1.75 Å

PDB Description: crispr-associated protein

PDB Compounds: (B:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d5h1pb_:

Sequence, based on SEQRES records:

>d5h1pb_ d.58.58.0 (B:) automated matches {Xanthomonas albilineans [TaxId: 380358]}
mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
pdidslrfyhlgakwearvehvgak

Sequence, based on observed residues (ATOM records):

>d5h1pb_ d.58.58.0 (B:) automated matches {Xanthomonas albilineans [TaxId: 380358]}
mmvlvsydvstpggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlidpd
idslrfyhlgakwearvehvgak

Timeline for d5h1pb_:

• d5h1pb_ first appeared in SCOPe 2.06
  
• d5h1pb_ appears in SCOPe 2.07