Lineage for d6aopa1 (6aop A:11-325)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (39 species)
    not a true protein
  7. 2371478Species Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340238] (1 PDB entry)
  8. 2371479Domain d6aopa1: 6aop A:11-325 [340239]
    Other proteins in same PDB: d6aopa2, d6aopb_
    automated match to d4xkga_
    complexed with bma, man, nag; mutant

Details for d6aopa1

PDB Entry: 6aop (more details), 2.3 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin l194p mutant apo form
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6aopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aopa1 b.19.1.0 (A:11-325) automated matches {Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd
qifpyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d6aopa1:

Click to download the PDB-style file with coordinates for d6aopa1.
(The format of our PDB-style files is described here.)

Timeline for d6aopa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6aopa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6aopb_