Lineage for d6aosb_ (6aos B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645412Species Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340208] (7 PDB entries)
  8. 2645418Domain d6aosb_: 6aos B: [340231]
    Other proteins in same PDB: d6aosa1, d6aosa2
    automated match to d1qfub_
    complexed with bma, gal, man, nag, sia; mutant

Details for d6aosb_

PDB Entry: 6aos (more details), 2.3 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin l194p mutant in complex with 3'-slnln
PDB Compounds: (B:) Hemagglutinin HA2chain

SCOPe Domain Sequences for d6aosb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aosb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6aosb_:

Click to download the PDB-style file with coordinates for d6aosb_.
(The format of our PDB-style files is described here.)

Timeline for d6aosb_: