SCOPe 2.07: Domain d6aoua1: 6aou A:11-325

Lineage for d6aoua1 (6aou A:11-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (19 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)

8. Domain d6aoua1: 6aou A:11-325 [340227]
   Other proteins in same PDB: d6aoua2, d6aoub_
   automated match to d2yp5a1
   complexed with bma, man, nag, sia

Details for d6aoua1

PDB Entry: 6aou, 1.75 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin in complex with 3'-slnln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6aoua1:

Sequence; same for both SEQRES and ATOM records:

>d6aoua1 b.19.1.2 (A:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd
qiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6aoua1:

• d6aoua1 first appeared in SCOPe 2.06
  
• d6aoua1 appears in the current release, SCOPe 2.08