Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (19 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries) |
Domain d6aoua1: 6aou A:11-325 [340227] Other proteins in same PDB: d6aoua2, d6aoub_ automated match to d2yp5a1 complexed with bma, man, nag, sia |
PDB Entry: 6aou (more details), 1.75 Å
SCOPe Domain Sequences for d6aoua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aoua1 b.19.1.2 (A:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd qiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk qntlklatgmrnvpe
Timeline for d6aoua1: