Lineage for d6aoub_ (6aou B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266930Species Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340208] (7 PDB entries)
  8. 2266933Domain d6aoub_: 6aou B: [340220]
    Other proteins in same PDB: d6aoua1, d6aoua2
    automated match to d1qfub_
    complexed with bma, man, nag, sia

Details for d6aoub_

PDB Entry: 6aou (more details), 1.75 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin in complex with 3'-slnln
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6aoub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aoub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6aoub_:

Click to download the PDB-style file with coordinates for d6aoub_.
(The format of our PDB-style files is described here.)

Timeline for d6aoub_: