SCOPe 2.07: Domain d6aoub_: 6aou B:

Lineage for d6aoub_ (6aou B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (14 species)
   trimer

7. Species Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340208] (7 PDB entries)

8. Domain d6aoub_: 6aou B: [340220]
   Other proteins in same PDB: d6aoua1, d6aoua2
   automated match to d1qfub_
   complexed with bma, man, nag, sia

Details for d6aoub_

PDB Entry: 6aou, 1.75 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin in complex with 3'-slnln

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6aoub_:

Sequence; same for both SEQRES and ATOM records:

>d6aoub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

Timeline for d6aoub_:

• d6aoub_ first appeared in SCOPe 2.06