SCOPe 2.08: Domain d1a98b_: 1a98 B:

Lineage for d1a98b_ (1a98 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)

7. Species Escherichia coli [TaxId:562] [53274] (7 PDB entries)

8. Domain d1a98b_: 1a98 B: [34022]

Details for d1a98b_

PDB Entry: 1a98, 2.25 Å

PDB Description: xprtase from e. coli complexed with gmp

PDB Compounds: (B:) xanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1a98b_:

Sequence, based on SEQRES records:

>d1a98b_ c.61.1.1 (B:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvaiss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppis

Sequence, based on observed residues (ATOM records):

>d1a98b_ c.61.1.1 (B:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvaisg
egfividdlvdttavairemypkahfvtifakpagrplvddyvvdipqdtwieqpwdmgv
vfvppis

Timeline for d1a98b_:

• d1a98b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a98b_ appears in SCOPe 2.07