SCOPe 2.06: Domain d6b8da2: 6b8d A:289-405

Lineage for d6b8da2 (6b8d A:289-405)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (26 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [340216] (1 PDB entry)

8. Domain d6b8da2: 6b8d A:289-405 [340217]
   Other proteins in same PDB: d6b8da1
   automated match to d2efga1
   complexed with cl

Details for d6b8da2

PDB Entry: 6b8d, 1.78 Å

PDB Description: 1.78 angstrom resolution crystal structure of n-terminal fragment (residues 1-405) of elongation factor g from haemophilus influenzae

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d6b8da2:

Sequence; same for both SEQRES and ATOM records:

>d6b8da2 b.43.3.0 (A:289-405) automated matches {Haemophilus influenzae [TaxId: 71421]}
ptdipaikginpdetegerhasdeepfsslafkiatdpfvgnltffrvysgvinsgdtvl
nsvrqkrerfgrivqmhankreeikevragdiaaaiglkdvttgdtlcaidapiile

Timeline for d6b8da2:

• d6b8da2 is new in SCOPe 2.06-stable
  
• d6b8da2 appears in SCOPe 2.07
  
• d6b8da2 appears in the current release, SCOPe 2.08