Lineage for d6aovb_ (6aov B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040832Species Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340208] (10 PDB entries)
  8. 3040834Domain d6aovb_: 6aov B: [340209]
    Other proteins in same PDB: d6aova1, d6aova2
    automated match to d1qfub_
    complexed with nag

Details for d6aovb_

PDB Entry: 6aov (more details), 1.75 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin in complex with 6'-slnln
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6aovb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aovb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6aovb_:

Click to download the PDB-style file with coordinates for d6aovb_.
(The format of our PDB-style files is described here.)

Timeline for d6aovb_: