Lineage for d6aqjb1 (6aqj B:2-182)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2432371Species Staphylococcus aureus [TaxId:273036] [340195] (1 PDB entry)
  8. 2432373Domain d6aqjb1: 6aqj B:2-182 [340206]
    Other proteins in same PDB: d6aqja2, d6aqjb2
    automated match to d4kqxb1
    complexed with 40e, edo, gol, hio, mg, ndp

Details for d6aqjb1

PDB Entry: 6aqj (more details), 1.37 Å

PDB Description: crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity.
PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6aqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqjb1 c.2.1.0 (B:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

SCOPe Domain Coordinates for d6aqjb1:

Click to download the PDB-style file with coordinates for d6aqjb1.
(The format of our PDB-style files is described here.)

Timeline for d6aqjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6aqjb2