SCOPe 2.06: Domain d6aosa1: 6aos A:11-325

Lineage for d6aosa1 (6aos A:11-325)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (25 species)
   not a true protein

7. Species Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId:476294] [340203] (2 PDB entries)

8. Domain d6aosa1: 6aos A:11-325 [340204]
   Other proteins in same PDB: d6aosa2, d6aosb_
   automated match to d2yp5a1
   complexed with bma, gal, man, nag, sia; mutant

Details for d6aosa1

PDB Entry: 6aos, 2.3 Å

PDB Description: crystal structure of the a/brisbane/10/2007 (h3n2) influenza virus hemagglutinin l194p mutant in complex with 3'-slnln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6aosa1:

Sequence; same for both SEQRES and ATOM records:

>d6aosa1 b.19.1.2 (A:11-325) automated matches {Influenza a virus (a/brisbane/10/2007(h3n2)) [TaxId: 476294]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtdnd
qifpyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6aosa1:

• d6aosa1 is new in SCOPe 2.06-stable
  
• d6aosa1 appears in SCOPe 2.07
  
• d6aosa1 appears in the current release, SCOPe 2.08