SCOPe 2.06: Domain d6aqja1: 6aqj A:2-182

Lineage for d6aqja1 (6aqj A:2-182)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [340195] (1 PDB entry)

8. Domain d6aqja1: 6aqj A:2-182 [340196]
   Other proteins in same PDB: d6aqja2, d6aqjb2
   automated match to d4kqxb1
   complexed with 40e, edo, gol, hio, mg, ndp

Details for d6aqja1

PDB Entry: 6aqj, 1.37 Å

PDB Description: crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity.

PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6aqja1:

Sequence; same for both SEQRES and ATOM records:

>d6aqja1 c.2.1.0 (A:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

Timeline for d6aqja1:

• d6aqja1 is new in SCOPe 2.06-stable
  
• d6aqja1 appears in SCOPe 2.07
  
• d6aqja1 appears in the current release, SCOPe 2.08