Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Staphylococcus aureus [TaxId:273036] [340195] (1 PDB entry) |
Domain d6aqja1: 6aqj A:2-182 [340196] Other proteins in same PDB: d6aqja2, d6aqjb2 automated match to d4kqxb1 complexed with 40e, edo, gol, hio, mg, ndp |
PDB Entry: 6aqj (more details), 1.37 Å
SCOPe Domain Sequences for d6aqja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqja1 c.2.1.0 (A:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]} ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet t
Timeline for d6aqja1: