SCOP 1.73: Domain d1a96c_: 1a96 C:

Lineage for d1a96c_ (1a96 C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)

7. Species Escherichia coli [TaxId:562] [53274] (5 PDB entries)

8. Domain d1a96c_: 1a96 C: [34019]

Details for d1a96c_

PDB Entry: 1a96, 2 Å

PDB Description: xprtase from e. coli with bound cprpp and xanthine

PDB Compounds: (C:) xanthine-guanine phosphoribosyltransferase

SCOP Domain Sequences for d1a96c_:

Sequence; same for both SEQRES and ATOM records:

>d1a96c_ c.61.1.1 (C:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppisgr

Timeline for d1a96c_:

• d1a96c_ first appeared (with stable ids) in SCOP 1.55
  
• d1a96c_ appears in SCOP 1.71
  
• d1a96c_ appears in SCOP 1.75
  
• d1a96c_ appears in the current release, SCOPe 2.08