Lineage for d5yh7a_ (5yh7 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443144Species Acinetobacter baumannii [TaxId:405416] [340181] (2 PDB entries)
  8. 2443145Domain d5yh7a_: 5yh7 A: [340182]
    automated match to d3f3ma_
    complexed with coa, so4

Details for d5yh7a_

PDB Entry: 5yh7 (more details), 2.03 Å

PDB Description: crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with coenzyme a at 2.0 a resolution
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5yh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yh7a_ c.26.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

SCOPe Domain Coordinates for d5yh7a_:

Click to download the PDB-style file with coordinates for d5yh7a_.
(The format of our PDB-style files is described here.)

Timeline for d5yh7a_: