SCOPe 2.06: Domain d1a96b_: 1a96 B:

Lineage for d1a96b_ (1a96 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)

7. Species Escherichia coli [TaxId:562] [53274] (7 PDB entries)

8. Domain d1a96b_: 1a96 B: [34018]
   complexed with bo3, mg, pcp, xan

Details for d1a96b_

PDB Entry: 1a96, 2 Å

PDB Description: xprtase from e. coli with bound cprpp and xanthine

PDB Compounds: (B:) xanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1a96b_:

Sequence; same for both SEQRES and ATOM records:

>d1a96b_ c.61.1.1 (B:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppisgr

Timeline for d1a96b_:

• d1a96b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a96b_ appears in SCOPe 2.05
  
• d1a96b_ appears in SCOPe 2.07
  
• d1a96b_ appears in the current release, SCOPe 2.08