Lineage for d1a96b_ (1a96 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891698Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)
  7. 2891699Species Escherichia coli [TaxId:562] [53274] (7 PDB entries)
  8. 2891707Domain d1a96b_: 1a96 B: [34018]
    complexed with bo3, mg, pcp, xan

Details for d1a96b_

PDB Entry: 1a96 (more details), 2 Å

PDB Description: xprtase from e. coli with bound cprpp and xanthine
PDB Compounds: (B:) xanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1a96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a96b_ c.61.1.1 (B:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppisgr

SCOPe Domain Coordinates for d1a96b_:

Click to download the PDB-style file with coordinates for d1a96b_.
(The format of our PDB-style files is described here.)

Timeline for d1a96b_: