Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species) |
Species Escherichia coli [TaxId:562] [53274] (7 PDB entries) |
Domain d1a96b_: 1a96 B: [34018] complexed with bo3, mg, pcp, xan |
PDB Entry: 1a96 (more details), 2 Å
SCOPe Domain Sequences for d1a96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a96b_ c.61.1.1 (B:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv ddyvvdipqdtwieqpwdmgvvfvppisgr
Timeline for d1a96b_: