SCOPe 2.08: Domain d5tnsb_: 5tns B:

Lineage for d5tnsb_ (5tns B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [255906] (33 PDB entries)

8. Domain d5tnsb_: 5tns B: [340174]
   automated match to d4dnod_
   complexed with 7ex; mutant

Details for d5tnsb_

PDB Entry: 5tns, 1.75 Å

PDB Description: crystal structure of the d129s mutant of the cftr inhibitory factor cif containing 1,2-epoxycyclohexane

PDB Compounds: (B:) CFTR inhibitory factor

SCOPe Domain Sequences for d5tnsb_:

Sequence; same for both SEQRES and ATOM records:

>d5tnsb_ c.69.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh

Timeline for d5tnsb_:

• d5tnsb_ first appeared in SCOPe 2.06
  
• d5tnsb_ appears in SCOPe 2.07