Lineage for d5vl3f2 (5vl3 F:107-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751603Domain d5vl3f2: 5vl3 F:107-209 [340160]
    Other proteins in same PDB: d5vl3a_, d5vl3b1, d5vl3c_, d5vl3d1, d5vl3e_, d5vl3f1, d5vl3h_, d5vl3l1
    automated match to d1dn0a2
    complexed with gol

Details for d5vl3f2

PDB Entry: 5vl3 (more details), 3.1 Å

PDB Description: cd22 d1-d3 in complex with therapeutic fab epratuzumab
PDB Compounds: (F:) Epratuzumab Fab Light Chain

SCOPe Domain Sequences for d5vl3f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl3f2 b.1.1.2 (F:107-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

SCOPe Domain Coordinates for d5vl3f2:

Click to download the PDB-style file with coordinates for d5vl3f2.
(The format of our PDB-style files is described here.)

Timeline for d5vl3f2: