![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
![]() | Protein automated matches [237402] (7 species) not a true protein |
![]() | Species Physcomitrella patens [TaxId:3218] [340155] (1 PDB entry) |
![]() | Domain d5w6ya_: 5w6y A: [340158] automated match to d4csma_ complexed with epe, trp |
PDB Entry: 5w6y (more details), 2 Å
SCOPe Domain Sequences for d5w6ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w6ya_ a.130.1.0 (A:) automated matches {Physcomitrella patens [TaxId: 3218]} lanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketetlhak vrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmylqdllpkltvpd ddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfk nvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvmpltkqvqvayll rrld
Timeline for d5w6ya_: