Class a: All alpha proteins [46456] (289 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
Protein automated matches [237402] (4 species) not a true protein |
Species Physcomitrella patens [TaxId:3218] [340155] (1 PDB entry) |
Domain d5w6yb_: 5w6y B: [340156] automated match to d4csma_ complexed with epe, trp |
PDB Entry: 5w6y (more details), 2 Å
SCOPe Domain Sequences for d5w6yb_:
Sequence, based on SEQRES records: (download)
>d5w6yb_ a.130.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 3218]} epftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketet lhakvrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmylqdllpkl tvpdddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailre ltfknvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvmpltkqvqv ayllrrld
>d5w6yb_ a.130.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 3218]} epftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketet lhakvrryqapdehpffpedlsqprvlhpaaekininksiwsmylqdllpkltvpdddgn ygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfknved nvkrrvankaraygqerykidpdlagalyedwvmpltkqvqvayllrrld
Timeline for d5w6yb_: