Lineage for d5u1bc_ (5u1b C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317328Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries)
  8. 2317343Domain d5u1bc_: 5u1b C: [340152]
    automated match to d1krqa_

Details for d5u1bc_

PDB Entry: 5u1b (more details), 2.81 Å

PDB Description: ferritin with gc mtre loop2 inserted at the n-terminus
PDB Compounds: (C:) MtrE protein,Ferritin chimera

SCOPe Domain Sequences for d5u1bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u1bc_ a.25.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d5u1bc_:

Click to download the PDB-style file with coordinates for d5u1bc_.
(The format of our PDB-style files is described here.)

Timeline for d5u1bc_: