Lineage for d5h4vf1 (5h4v F:2-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861256Species Xanthomonas oryzae [TaxId:291331] [339991] (1 PDB entry)
  8. 2861262Domain d5h4vf1: 5h4v F:2-298 [340148]
    Other proteins in same PDB: d5h4va2, d5h4vb2, d5h4vc2, d5h4vd2, d5h4ve2, d5h4vf2
    automated match to d4g6za1

Details for d5h4vf1

PDB Entry: 5h4v (more details), 3 Å

PDB Description: structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae
PDB Compounds: (F:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d5h4vf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4vf1 c.26.1.0 (F:2-298) automated matches {Xanthomonas oryzae [TaxId: 291331]}
acrtrfapsptgylhiggartalycwlearrrggqfvlriedtdrqrstqaaidaileam
qwlglgydegpiyqtqrvaryqevaeqllaqgkayyayetreeldamreaamakqekpry
dgaareqnlpyrddpnrvirfknpiggtvvfddlikgrieianselddmvifrpdglpty
nfavvvddwdmgitevirgddhinntprqiniyaalgapvpkfahmpmildeqgtklskr
tgaadvmqykdagylphalinylarlgwshgdqelftpqelldlfdvkdvnskaarl

SCOPe Domain Coordinates for d5h4vf1:

Click to download the PDB-style file with coordinates for d5h4vf1.
(The format of our PDB-style files is described here.)

Timeline for d5h4vf1: