Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries) |
Domain d5u1bb_: 5u1b B: [340137] automated match to d1krqa_ |
PDB Entry: 5u1b (more details), 2.81 Å
SCOPe Domain Sequences for d5u1bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1bb_ a.25.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]} mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d5u1bb_: