Lineage for d5tndc_ (5tnd C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153257Species Pseudomonas aeruginosa [TaxId:208963] [255906] (33 PDB entries)
  8. 2153308Domain d5tndc_: 5tnd C: [340135]
    automated match to d4dnod_
    complexed with 3zq, 40o; mutant

Details for d5tndc_

PDB Entry: 5tnd (more details), 1.55 Å

PDB Description: crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted 1,2-epoxycyclohexane hydrolysis intermediate
PDB Compounds: (C:) CFTR inhibitory factor

SCOPe Domain Sequences for d5tndc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tndc_ c.69.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh

SCOPe Domain Coordinates for d5tndc_:

Click to download the PDB-style file with coordinates for d5tndc_.
(The format of our PDB-style files is described here.)

Timeline for d5tndc_: