Lineage for d5v7ib_ (5v7i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896255Protein Serine hydroxymethyltransferase [53429] (7 species)
  7. 2896310Species Human (Homo sapiens), mitochondrial [TaxId:9606] [142671] (9 PDB entries)
    Uniprot P34897 42-504
  8. 2896320Domain d5v7ib_: 5v7i B: [340115]
    automated match to d3ou5a_
    complexed with 8z1, gly, gol, peg

Details for d5v7ib_

PDB Entry: 5v7i (more details), 2.47 Å

PDB Description: crystal structure of homo sapiens serine hydroxymethyltransferase 2 (mitochondrial) (shmt2), in complex with glycine, plp and folate- competitive pyrazolopyran inhibitor: 6-amino-4-isopropyl-3-methyl-4- (3-(pyrrolidin-1-yl)-5-(trifluoromethyl)phenyl)-1,4-dihydropyrano[2, 3-c]pyrazole-5-carbonitrile
PDB Compounds: (B:) Serine hydroxymethyltransferase, mitochondrial

SCOPe Domain Sequences for d5v7ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v7ib_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh

SCOPe Domain Coordinates for d5v7ib_:

Click to download the PDB-style file with coordinates for d5v7ib_.
(The format of our PDB-style files is described here.)

Timeline for d5v7ib_: