Lineage for d5t7ga2 (5t7g A:182-274)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026491Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
    Uniprot P01901 22-299
  8. 2026576Domain d5t7ga2: 5t7g A:182-274 [340103]
    Other proteins in same PDB: d5t7ga1, d5t7gb_, d5t7gc1, d5t7gd_
    automated match to d1qo3a1
    complexed with edo

Details for d5t7ga2

PDB Entry: 5t7g (more details), 1.96 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pt9) of hiv gp120 mn isolate (igpgrafyt)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5t7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ga2 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkeqkytchveheglpepltlrw

SCOPe Domain Coordinates for d5t7ga2:

Click to download the PDB-style file with coordinates for d5t7ga2.
(The format of our PDB-style files is described here.)

Timeline for d5t7ga2: