Lineage for d5t7ga1 (5t7g A:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545128Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2545143Domain d5t7ga1: 5t7g A:2-181 [340102]
    Other proteins in same PDB: d5t7ga2, d5t7gb_, d5t7gc2, d5t7gd_
    automated match to d1qo3a2
    complexed with edo

Details for d5t7ga1

PDB Entry: 5t7g (more details), 1.96 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pt9) of hiv gp120 mn isolate (igpgrafyt)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5t7ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ga1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOPe Domain Coordinates for d5t7ga1:

Click to download the PDB-style file with coordinates for d5t7ga1.
(The format of our PDB-style files is described here.)

Timeline for d5t7ga1: