SCOPe 2.07: Domain d5t7ga1: 5t7g A:2-181

Lineage for d5t7ga1 (5t7g A:2-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d5t7ga1: 5t7g A:2-181 [340102]
   Other proteins in same PDB: d5t7ga2, d5t7gb_, d5t7gc2, d5t7gd_
   automated match to d1qo3a2
   complexed with edo

Details for d5t7ga1

PDB Entry: 5t7g, 1.96 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pt9) of hiv gp120 mn isolate (igpgrafyt)

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5t7ga1:

Sequence; same for both SEQRES and ATOM records:

>d5t7ga1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

Timeline for d5t7ga1:

• d5t7ga1 first appeared in SCOPe 2.06
  
• d5t7ga1 appears in the current release, SCOPe 2.08