Lineage for d2bifb2 (2bif B:250-468)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25834Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 25835Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (1 species)
  7. 25836Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)
  8. 25844Domain d2bifb2: 2bif B:250-468 [34010]
    Other proteins in same PDB: d2bifa1, d2bifb1

Details for d2bifb2

PDB Entry: 2bif (more details), 2.4 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase h256a mutant with f6p in phosphatase active site

SCOP Domain Sequences for d2bifb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bifb2 c.60.1.4 (B:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
siylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

SCOP Domain Coordinates for d2bifb2:

Click to download the PDB-style file with coordinates for d2bifb2.
(The format of our PDB-style files is described here.)

Timeline for d2bifb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bifb1