![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein) |
![]() | Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species) bifunctional enzyme |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries) |
![]() | Domain d2bifa2: 2bif A:250-468 [34009] Other proteins in same PDB: d2bifa1, d2bifb1 |
PDB Entry: 2bif (more details), 2.4 Å
SCOP Domain Sequences for d2bifa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)} siylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq
Timeline for d2bifa2: