SCOP 1.61: Domain d2bifa2: 2bif A:250-468

Lineage for d2bifa2 (2bif A:250-468)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)

8. Domain d2bifa2: 2bif A:250-468 [34009]
   Other proteins in same PDB: d2bifa1, d2bifb1

Details for d2bifa2

PDB Entry: 2bif, 2.4 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase h256a mutant with f6p in phosphatase active site

SCOP Domain Sequences for d2bifa2:

Sequence; same for both SEQRES and ATOM records:

>d2bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
siylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

Timeline for d2bifa2:

• d2bifa2 first appeared (with stable ids) in SCOP 1.55
  
• d2bifa2 appears in SCOP 1.59
  
• d2bifa2 appears in SCOP 1.63
  
• d2bifa2 appears in the current release, SCOPe 2.08