Lineage for d5tnma_ (5tnm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902704Species Pseudomonas aeruginosa [TaxId:208963] [255906] (33 PDB entries)
  8. 2902757Domain d5tnma_: 5tnm A: [340073]
    automated match to d4dnod_
    complexed with 7f2; mutant

Details for d5tnma_

PDB Entry: 5tnm (more details), 1.7 Å

PDB Description: crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted (r)-1,2-epoxyoctane hydrolysis intermediate
PDB Compounds: (A:) CFTR inhibitory factor

SCOPe Domain Sequences for d5tnma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tnma_ c.69.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrh

SCOPe Domain Coordinates for d5tnma_:

Click to download the PDB-style file with coordinates for d5tnma_.
(The format of our PDB-style files is described here.)

Timeline for d5tnma_: