SCOPe 2.08: Domain d5tirc2: 5tir C:91-208

Lineage for d5tirc2 (5tir C:91-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)

8. Domain d5tirc2: 5tir C:91-208 [340067]
   Other proteins in same PDB: d5tira1, d5tirb1, d5tirc1, d5tird1
   automated match to d1bsma2
   complexed with mn; mutant

Details for d5tirc2

PDB Entry: 5tir, 1.62 Å

PDB Description: crystal structure of mn superoxide dismutase mutant m27v from trichoderma reesei

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d5tirc2:

Sequence; same for both SEQRES and ATOM records:

>d5tirc2 d.44.1.0 (C:91-208) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkil

Timeline for d5tirc2:

• d5tirc2 first appeared in SCOPe 2.06
  
• d5tirc2 appears in SCOPe 2.07