SCOPe 2.06: Domain d5t7gc2: 5t7g C:182-274

Lineage for d5t7gc2 (5t7g C:182-274)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d5t7gc2: 5t7g C:182-274 [340050]
   Other proteins in same PDB: d5t7ga1, d5t7gb_, d5t7gc1, d5t7gd_
   automated match to d1qo3a1
   complexed with edo

Details for d5t7gc2

PDB Entry: 5t7g, 1.96 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pt9) of hiv gp120 mn isolate (igpgrafyt)

PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5t7gc2:

Sequence; same for both SEQRES and ATOM records:

>d5t7gc2 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkeqkytchveheglpepltlrw

Timeline for d5t7gc2:

• d5t7gc2 is new in SCOPe 2.06-stable
  
• d5t7gc2 appears in SCOPe 2.07
  
• d5t7gc2 appears in the current release, SCOPe 2.08