![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries) |
![]() | Domain d5t7gc1: 5t7g C:2-181 [340049] Other proteins in same PDB: d5t7ga2, d5t7gb_, d5t7gc2, d5t7gd_ automated match to d1qo3a2 complexed with edo |
PDB Entry: 5t7g (more details), 1.96 Å
SCOPe Domain Sequences for d5t7gc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t7gc1 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr
Timeline for d5t7gc1:
![]() Domains from other chains: (mouse over for more information) d5t7ga1, d5t7ga2, d5t7gb_, d5t7gd_ |