SCOPe 2.06: Domain d5ovoa_: 5ovo A:

Lineage for d5ovoa_ (5ovo A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
   multihelical; bundle

4. Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families)

5. Family a.209.1.0: automated matches [191592] (1 protein)
   not a true family

6. Protein automated matches [191071] (2 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries)

8. Domain d5ovoa_: 5ovo A: [340045]
   Other proteins in same PDB: d5ovob_
   automated match to d3o5ta_
   complexed with adp, mg, mn

Details for d5ovoa_

PDB Entry: 5ovo, 1.55 Å

PDB Description: structure of drag-glnz-delta42-54 complex from azospirillum brasilense

PDB Compounds: (A:) ADP-ribosyl-(Dinitrogen reductase) hydrolase

SCOPe Domain Sequences for d5ovoa_:

Sequence; same for both SEQRES and ATOM records:

>d5ovoa_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt
emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey
hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd
vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg
dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg

Timeline for d5ovoa_:

• d5ovoa_ is new in SCOPe 2.06-stable
  
• d5ovoa_ appears in SCOPe 2.07
  
• d5ovoa_ appears in the current release, SCOPe 2.08